Lettuce Deliver online store

Raw

Amazonia

Amazonia Acai Powder 145gm

$44.95 each

Eyjpzci6ija3zwmwywe5mtllnzkxyjizytmymzm3otflogzimjy5iiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=9377893f7e7ce4923db84d9a18588f2b1e6ee3a8074c586ae0ad0105ea206aa5

Amazonia Freeze-Dried Acai is a completely natural whole superfood. The certified organic acai berries are grown wild and harvested in the Amazonia rainforest. From this premium grade acai pulp, Amazonia acai powder is made in Australia through a gentle freeze-drying process, where temperatures are kept below 40 degrees Celsius for maximum nutrient retention. This delicious superfood tastes like a blend of berries and chocolate and has 42 times the antioxidants of blueberries and 10 times that of spirulina. Amazonia Freeze-Dried Acai comes with a guarantee of being the purest and most potent you can get and is completely sustainable, so the choice is easy. It?s the perfect addition to your smoothies, breakfast bowls, juices or sprinkled on cereal. Organic & Fair Trade Acai. Gluten-free, wild-gathered, raw & vegan. 100% pure freeze dried acai, no fillers or additives, Superior antioxidant value, Proudly sustainable.

Gluten Free, Certified by ACO, Raw, Vegan, Vegetarian, Fair Trade ...

Absolute Organic

Absolute Organic Almond Meal 250g

$13.70 each

Eyjpzci6imq4mjvkzmvlntnlngiznmnln2i1njrkn2u4zgyxmdu1lmpwzyisinn0b3jhz2uioijwdwjsawnfc3rvcmuifq?signature=a4733380b40853741c258722085a9b96fedaafabb7445f5af68cbbefdf0532af

Certified Organic Almond Meal is from raw blanched whole almonds that have been ground into a fine powder.

Certified by ACO, Raw ...

The Health Food Guys Co.

The Health Food Guys Co. Bar - Raw Protein - Cacao Goji Bar 55gm

$4.65 each

Eyjpzci6imexogjhmtmyndqzyjk5ytq3nwuxzdrmmzm5nzjjotu3iiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=443c8e15188c929aeea02fbd41b05db4f2ee069365bf0421601e24d784dcd07c

The Health Food Guys' raw protein Cacao Goji bar is a chocolaty protein fix that offers a rich source of antioxidants from both the Cacao and the Goji berry. Improving body function and filling the body with nutrients and vitamins not found in more one dimensional snacks.

Raw ...

The Health Food Guys Co.

The Health Food Guys Co. Bar - Raw Protein - Maca Bar 55gm

$4.65 each

Eyjpzci6ijkxmddmmwe1mjqzodc4nweyyzi3mtuwntuzmjy4mju0iiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=2edce3dd3a0a01c370602e099de2ae7cfe1df18f41c88db8f3bb7e6795de9cb2

Raw protein Maca bars are a unique offering to the health conscious consumer, containing the best quality organic and super food ingredients selected to provide a balanced and nutritious protein health bar. Where possible all ingredients have been sourced from organic producers ensuring the highest possible nutrient value without the potentially harmful side effects of residual pesticides and chemicals. Ingredients are raw, ensuring that naturally occurring enzymes and vitamins are retained in the product.

Raw ...

The Health Food Guys Co.

The Health Food Guys Co. Bar - Raw Protein - Vanilla Blueberry 55gm

$4.65 each

Eyjpzci6ijiwzde1ztk5njm1ytfjmtyzmwjhzmm4nge5yjjmnzgziiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=3a09e2394b76e4e2e9fc99c309d07eb8c12340962f6d4334862a8c316b0bdbac

The Health Food Guys' raw protein Vanilla Blueberry bar is a fruity protein fix that offers a rich source of antioxidant anthocyanin and anti-inflammation. Improving body function and filling the body with nutrients and vitamins not found in one dimensional snacks.l

Raw ...

Cabot. Sandra

Cabot. Sandra Book - Raw Juices Can Save Your Life

$20.80 each

Eyjpzci6ijnhmdezztcznmu2yjqxmtjlzte0nwqznjllnta1zwjliiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=c061ad6f923b74adc5bde461851dda69e823ca9db2a6d9c216e81a7c72332b8d

Raw juices can save your life. In this day and age where computers diagnose disease and perform surgery, we tend to minimize natural therapies. The simple act of drinking raw juice could turn arounf severe disease. This is an A-Z guide of juicing which contains carefully designed juices for specific ailments. eg Ance, Diabetes PLUS Rejuvinating Juice Therapies

Raw ...

Loving Earth

Loving Earth Cacao Butter (Virgin) - Raw 250gm

$16.25 each

Eyjpzci6ijm4mmrkmdzmmmu4zwezotm5yzk3ota0ndg3m2exzmu4iiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=43a0c566f42633cc9906b5b4436f17da9ce96a47b91c33f6d35108dd77e0e297

Organic Virgin Cacao Butter made from fairly traded criollo cacao from Satipo in Peru. This cacao butter is made by pressing the Raw Cacao Nibs to preserve the full vitality of the raw cacao.

Certified by ACO, Raw ...

Loving Earth

Loving Earth Cacao Powder - Raw 500gm

$16.80 each

Eyjpzci6ijqzyza5ntaymzc3odhmmmzmmzrmnjjmotg2owjimdm2lmpwzyisinn0b3jhz2uioijwdwjsawnfc3rvcmuifq?signature=08567562a8149bf9eae33fd43e5bcc9bf5eb872ea0bfdbbe9f84cf14a759d206

Organic Cacao Powder from Satipo in the Peruvian Amazon. Jam packed with antioxidants and bliss nutrients that can help keep you energised, healthy and happy.

Mix a tablespoon with your favorite smoothie, milkshake or recipe to give it a rich chocolate twist.

Certified by ACO, Raw ...

Loving Earth

Loving Earth Chocolate - Raw - Turkishly Delightful 45gm

$4.95 each

Eyjpzci6ijm5mgm4zgq3m2njztjimde0ndyxytzmzja4ztvhmdi3iiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=a16bf9dfa576df2cedb4f71de7d3ffbdaf9bcef0ac7c3378d8cf25b0ea66e88b

A vegan version of the old classic Turkish Delight. Loving Earth has added chewy cranberries and rose oil to create a sensual chocolate bar.

Certified by ACO, Raw, Vegan, Vegetarian ...

Loving Earth

Loving Earth Chocolate - Raw Creamy (Coconut Mylk) 80gm

$6.80 each

Eyjpzci6ijiwngnkmwvimjizzwu4mzriztllmze3zdyyzjg4nzbmiiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=300d4530018183c64192012a5d53b3f3740417ed673cc4daa5bd1f4de8cf0522

Single Origin. Vegan. Cane Sugar Free. Compostable packaging. Soy Free. Dairy Free. Delicious! Really Raw Chcocolate - Bean to Bar.

Certified by ACO, Raw, Vegan, Vegetarian ...

Loving Earth

Loving Earth Chocolate - Raw Dark (72% Cacao) 30gm

$2.86 each

Eyjpzci6iju1zde0mtrmmddkmgmwmmvhmtdkmgvimdqwndvjnzgxiiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=bea271ee9ded847498ab064cc717575a9cc8d95877884fb4abc111a3c2fd7865

A bold and simple blend of Raw Cacao Beans and Coconut Nectar. Single Origin. Vegan. Cane Sugar Free. Compostable packaging. Soy Free. Dairy Free. Delicious! Really Raw Chocolate - Bean to Bar.

Certified by ACO, Raw, Vegan, Vegetarian ...

Loving Earth

Loving Earth Chocolate - Raw Dark (72% Cacao) 80gm

$6.80 each

Eyjpzci6imvmyzuxodbizwq5mjizmzninmi1yzk4ztk5mjmymtrjiiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=3fe058d2d27121c20d90083b1127812b3160333f4521899ddc07d6f74d1acd03

Soy Free. Dairy Free. Delicious! Really Raw Chocolate - Bean to Bar.

Certified by ACO, Raw ...

Pana

Pana Chocolate - Raw Mint (60% Cacao) 45gm

$7.10 each

Eyjpzci6imewy2jimtblowvmyte4mdy5njrjnwq0mdm3ntm3ztzhiiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=6aca48fc4e515c37806f9b4de42eb8c17b87408d9276e08935436089d39facd9

Made with pure essential peppermint oil, this certified organic chocolate is raw, hand-made, free from gluten, dairy and soy.

Gluten Free, Certified by ACO, Raw ...

Loving Earth

Loving Earth Chocolate - Raw Raspberry Mylk (44% Cacao) 80gm

$6.80 each

Eyjpzci6imqymwyynwq4ntkwmzlkzwe1nzk4zgfmyte0mjbhmwe4iiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=8b642e60a98001a00815b3e5184cbaebb66fbc5281d7ded9a28f804c2cff4ff7

This Raspberry Cashew Mylk Chocolate is made with Amazonico Criollo, single origin Certified Organic Raw Cacao (44%) from Peru, creamy raw cashews with the tang of raspberries and sweetened with Organic Evaporated Coconut Sugar. Dairy free, vegan, cane sugar free, GMO free, gluten free & soy free!

Gluten Free, Certified by ACO, Raw, Vegan, Vegetarian ...

Pana Chocolate

Pana Chocolate Chocolate - Raw Sour Cherry & Vanilla (60% Cacao) 45gm

$7.10 each

Eyjpzci6ijdlnmfkogm2nzeyyzixmwvmytu1odiwnwfhmwixy2uyiiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=46370b8106f601fcf6c28fe5d3397be65c86204449fdee43d07ecbf69e522e4f

This certified organic chocolate is raw, hand-made, free from gluten, dairy and soy.

Gluten Free, Certified by ACO, Raw ...

Kookas Natural

Kookas Natural Cookies - Raw Cacao Macadamia 180gm

$13.40 each

Eyjpzci6imjkm2jhywniymjlztvmmwq3mzvkyzmzzjkxmza1zguwiiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=3615cf5f6ee6a78cf1425e97597ea200963459cc699b46ccddf93cf6a759a8a1

Loaded with 100% organic raw cacao powder and Australian macadamia nuts, this very delicious - and very addictive - macadamia cookie exudes all the natural health benefits and antioxidants that you get from raw cacao, with the familiar crunch of fresh macadamia. 100% Natural. Dairy and egg free. No refined sugar.

Raw ...

KITZ Living Foods

KITZ Living Foods Crackers - Raw Gourmet 4 Seed 100gm

$11.99 each

Eyjpzci6imm0nwq1mdlkmtm5otdhodbimtvhn2nmmgfkmju2nmfhiiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=5f7d25055330574ccd029a36223b619b71708d57f7cde54faa31b5a7807c6d74

These are so gourmet, because they are not savoury or sweet you can use them however you wish, with dips, pate's etc or maybe sliced banana with a drizzle of honey or agave. Free from wheat, gluten, dairy, soy, egg, grains, yeast, artificial colours and preservatives. Raw, vegan and highly nutritious.l

Gluten Free, Raw, Vegan, Vegetarian ...

KITZ Living Foods

KITZ Living Foods Crackers - Raw Italian Herb & Garlic 100gm

$11.99 each

Eyjpzci6ijy4m2yzotrlzdhhyjdlogniywjlnwe4zdu2ztuxnze0iiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=b8fd5f170a0f8a4d6d9872aaf49c27aea760402bc1dff16a1ea09a869d402fd5

Started with activated flax and sunflower seeds, then mixed with a lavish helping of garlic herbs to make this cracker one of KITZ most popular. Delicious with avocado's, sprouts and black pepper!

Raw ...

Kehoe's Kitchen

Kehoe's Kitchen Dip - Cashew With Chilli 250gm

$11.25 each

Eyjpzci6ijqwnguwzwjmndcyy2u2odk5oge5yzi0ymzjodazngfjiiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=f7122d0738e5865a266369baa8b68f20688568288fb7acd1e7c76ebecd8f9a51

Instead of fermenting milk to make cream cheese, we ferment cashews using the same traditional fermentation process.

This means our range of probiotic, wholefood Cashew ‘Cheese” dips/spreads taste like real dairy cheese without using any flavours, colours, thickeners, starch, preservatives or gums.

Fermentation creates lactic acid (and lots of probiotics), so the dips are naturally acidic and will keep for months in the fridge even after opening.

Our Chilli Cashew Cheese is flavoured with real ingredients; organic chilli, organic garlic, organic onion, organic turmeric, organic apple, organic ginger and natural sea salt, giving it a delicious “chilli/laksa” cheese flavour

Certified by ACO, Raw, Vegan, Vegetarian, Paleo ...

Kehoe's Kitchen

Kehoe's Kitchen Garlic Paste

$15.10 each

Eyjpzci6ijawodm0mdu0zwu3zwjizgnhnmzjnde2yzq5mdhhnzjilmpwzyisinn0b3jhz2uioijwdwjsawnfc3rvcmuifq?signature=2d69da825d61e4c0ebd226fc7604ade642fa25788358db5daecca88acfc06d25

Australian Grown, Certified Organic, fully fermented garlic paste. Easier to digest, smoother tasting.

Certified by ACO, Australian Made, Raw, Fermented ...

Foley’s

Foley’s Gut Shots – Raw Ginger Beet Kraut Juice 350ml

$7.75 each

Eyjpzci6iji5zdkwmmzhzmjhztjlm2e4nmjjyzgwmdq1zgjknwvhlmpwzwcilcjzdg9yywdlijoichvibgljx3n0b3jlin0?signature=49f156daba161abbb8b85e756c571040303b3495848a82769ea69091b85cef0d

Populate and re-balance your gut flora with a quick and easy Gut Shot perfect for the daily probiotic hit. From as little as 30ml a day, you can enjoy the array of benefits to your guy health that comes from raw, fermented sauerkraut in just one shot. Great for gut issues, boosting your immune system, aiding digestion and also helps with acid reflux.

Raw, Fermented ...

Foley’s

Foley’s Gut Shots – Raw Turmeric Kraut Juice 350ml

$7.75 each

Eyjpzci6ijzlogi1mzjkytm4ntnmztzmode4yjjizme5mmmwmwixlmpwzwcilcjzdg9yywdlijoichvibgljx3n0b3jlin0?signature=fbac84a15a0c86a141243d13a33e552b88cb9a197aadce46945fa3f9902a13a5

Populate and re-balance your gut flora with a quick and easy Gut Shot perfect for the daily probiotic hit. From as little as 30ml a day, you can enjoy the array of benefits to your guy health that comes from raw, fermented sauerkraut in just one shot. Great for gut issues, boosting your immune system, aiding digestion and also helps with acid reflux.

Raw, Fermented ...

Blis

Blis Honey - Manuka (Mgo 150+) 250gm

$54.00 each

Eyjpzci6ijixnmjkzdzhzjexzji3mgvkztdkowi5n2rmnmi3m2filnbuzyisinn0b3jhz2uioijwdwjsawnfc3rvcmuifq?signature=e2d0da723f5ef321c625c8b29cabc49c7a420e2d2063dc35e87fca207ed3b070

BLIS Manuka Honey 150+ is fully certified organic, raw, unheated and the highest quality you can get. It is perfect for helping to naturally soothe sore throats, reduce the appearance of scars, eliminate skin infections and heal minor cuts and burns. It also can help aid digestion and is often used to improve general health and wellbeing (especially during the colder month) making it one of nature's miraculous healers. BLIS Manuka Honey comes from the Nelson - Tasman region of New Zealand where a coastal paradise exists. Surrounded by three National Parks, Blis bees make their home amongst the beautiful crystal clear streams and enchanting native forests. It is here with love, passion and the most natural Biodynamic beekeeping methods that this precious raw organic Manuka honey is created.

Certified by INTL , Raw ...

Blis

Blis Honey - Manuka (Mgo 600+) 250gm

$92.00 each

Eyjpzci6ijzjzdm5ognhotc5nmy3otqzn2e4njbjzmmynmzhmzqyiiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=82bd76ea2d4a8d9d10cb40864bd74b252f32e4c4a8c0c45d436473a948944541

BLIS Manuka Honey 600+ is fully certified organic, raw, unheated and the highest quality you can get. It is perfect for helping to naturally soothe sore throats, reduce the appearance of scars, eliminate skin infections and heal minor cuts and burns. It also can help aid digestion and is often used to improve general health and wellbeing (especially during the colder month) making it one of nature's miraculous healers. BLIS Manuka Honey comes from the Nelson - Tasman region of New Zealand where a coastal paradise exists. Surrounded by three National Parks, Blis bees make their home amongst the beautiful crystal clear streams and enchanting native forests. It is here with love, passion and the most natural Biodynamic beekeeping methods that this precious raw organic Manuka honey is created.

Certified by INTL , Raw ...

Goomboorian Gold

Goomboorian Gold Honey - Manuka (Mgo 90+) 500gm

$26.50 each

Eyjpzci6imnhy2yyzgqxyzmyzwu4otcxzdy5ntm5owy3owq4ywfiiiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=ff71ce3793a68f7e8e8c6372f88a777862762af7879dc0b43211d1cfe248cc3e

Now you can enjoy the satisfying sensation and delicious taste of Goomboorian Gold Organic Raw Honey. Gooboorian Gold is not fully filtered or heated which ensures you receive its nutritious benefits. Goomboorian Honey contains antioxidants, enzymes, amino acids, vitamins & minerals.

Raw ...

Pim's Organics

Pim's Organics Honey - Pure Natural (Raw) 400gm

$9.95 each

Eyjpzci6ime1mgnhnjvimtbkmwzmndvlymzhmdkwmgywndu1yzg5iiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=4fc05af794b0f63b34607c14e60cc0f810d455b234784aa83f6a743a75d70f93

Delicious honey coming from Pim Mens in Glasshouse Mountain. The honey is not certified organic, but it does come from Pim's certified organic farm. Bees can travel up to 6km to collect pollens, and as Pim's neighbour is only about 1.5km away, the honey cannot be certified.

Raw ...

Pureharvest

Pureharvest Honey - Raw 500gm

$13.95 each

Eyjpzci6ija1mdk4mtc3nmu0owqwowi4njrknzk5zdhjyzi3m2uziiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=75de900051889f974d1df2f0df75ceb2b10bc6a72cb5f38e4606f391a395cec1

Pureharvest Certified Organic Honey is a full flavoured natural sweetener sourced entirely from within Australia. The honey is harvested away from industrial areas, sanitary landfills or garbage dumps. Honey is not heated over 45?C to retain optimum levels of enzymes and nutrition. Natural honey may crystallise; place jar in pan of hot water to liquefy.

Certified by ACO, Raw ...

Ambrosia

Ambrosia Honey - Raw 500gm

$13.95 each

Eyjpzci6imywyjvlzjfiogqznze5zmzmnzjizmy1zmq4mjkzmmjiiiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=49fa05bd3a88cc9308dd3fbfed418e43925c85c68f5363726b616475d0ad8478

This honey is delicious

Certified by NASAA, Raw ...

Ambrosia

Ambrosia Honey - Raw 1kg

$29.95 each

Eyjpzci6ija0yjgxyjfhztq1mdgzytu1njcxywu4yme3zdk2mzjkiiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=2630836ac1e28e2aa96caa3c7d92bbf0b590342165d758eb19e53a9e87b3c1b1

This honey is delicious

Certified by NASAA, Raw ...

Berringa

Berringa Honey - Raw & Unfiltered (Eucalyptus) 500gm

$20.20 each

Eyjpzci6imexy2mzztyzywi3zdcxzmyxmzfkzdm1mzgyyzy4nthhiiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=0a4944964973288d6abdbfd7f72e5be201a8c2716fac293d7e8c15afd37d8249

Berringa's 100% Pure Australian Raw & Unfiltered Honey has been minimally processed.

Certified by ACO, Raw ...

Kehoe's Kitchen

Kehoe's Kitchen Kim Chi (Gold) 410gm

$11.25 each

Eyjpzci6imfizdu5ytrmyzi3owi1yjixmdhhndiwmwjmodc5nji3iiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=16ea5039b18ddc2f9474cf9b5fef8187515301d9d0f54397c3e0d3103578b606

Vegan. Raw - loaded with good bacteria. These sauerkrauts are dry salted and fully fermented before being jarred. The nutritional benefits are increased by the traditional fermentation process. A more mature kraut guarantees plentiful bacteria and a full bodied flavour. The kraut also becomes more acidic and acts as a digestive enzyme, allowing easier digestion and absorption or more nutrients.

Certified by ACO, Raw, Vegan, Vegetarian, Fermented ...

Foley’s

Foley’s Kim Chi (Raw) 250g

$8.90 each

Eyjpzci6ijyyzja2zjbkmmq4yjnmntblnda0yzzhzjkwmmvknwmxlmpwzyisinn0b3jhz2uioijwdwjsawnfc3rvcmuifq?signature=9c1816acaddbce3cf820819f2a9c1d8c3b87ec58ef3234cf794af1f7879accd9

Stimulate digestion. Built with extra kick, Kim-Chi is hapkido on the taste buds. An ancient Korean health staple, Foley’s recipe is bursting with vegetable, Tasmanian Wakame seaweed and powerful Cayenne Peppers. Probiotic-rich and full of Vitamins A, C, B1, B2, Calcium and Iron, Foleys Raw Kim-Chi will help your gut digest food faster, enabling more time to process and distribute nutrition. Natural Probiotic. Paleo. Vegan. Gluten Free.

Raw, Vegan, Fermented, Paleo ...

Gutsy

Gutsy Kraut - Apple Radish Kimchi 450gm

$15.25 each

Eyjpzci6ijaynzvhnzc2yjlmmtriztezzmm5odzlyjyyy2myndljiiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=64af1960160b43f08ede843ccdc0aeac9103a61982d64d8e233420bd588bf0d0

Oak barrel aged. Wildly fermented for 4 - 6 weeks. Raw and Unheated. Contains trillions of good bacteria. 100% Australian. Full of flavour and comes with a spicy kick. Add me to crispy fried eggs, beef bulgogi pizza, pulled pork tacos with slaw or even a rainbow salad quinoa bowl.

Certified by ACO, Raw, Fermented ...

Gutsy

Gutsy Kraut - Carrot, Ginger & Turmeric 450gm

$15.25 each

Eyjpzci6imuwndi1njy2ndhinwq1n2yznge1otuymjbinwe4zdy5iiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=6f57ee7adfdb7b73360425446a43ad18df75793618e57103947cba533e140f21

Oak barrel aged. Wildly fermented for 4 - 6 weeks. Raw and Unheated. Contains trillions of good bacteria. 100% Australian. Best with asian dishes and egg dishes. Cashew nut & beef stir fry, Vietnamese spring rolls, veggie gyoza, Thai inspired salads, or even serve next to a steaming bowl of dhal.

Certified by ACO, Raw, Fermented ...

Made By Cow

Made By Cow Milk - Cold Pressed Raw (Jersey) 750ml

$3.99 each

Eyjpzci6imizymjjy2y1njc3zti5mjq0yzkwyjrmywm3m2u0nmeziiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=66efb8b6b76f2517c4669a8633d317ef6d16009d7c89c4c094ec69c7b3c60575

The world's first safe to drink cold pressed raw milk. Made By Cow uses a NSW Food Authority approved, new method that focuses on careful herd management and more hygienic milking practices from a single Jersey Herd on the NSW South Coast, to produce a higher quality milk. This is then bottled straight from the cow within hours and put under intense water pressure, compressing both the bottle and milk inside for several minutes. This pressure gets rid of any remaining harmful bacteria, whilst being gentler on milk?s natural nutrients. It arrives to us each Monday with a 15 - 20 day expiry. This product is ordered at 4pm Sunday. Orders placed after this time, will not be able to be fulfilled.

Raw ...

Made By Cow

Made By Cow Milk – Lactose Free Cold Pressed Raw 1.5l

$5.65 each

Eyjpzci6imm5mmziyjm5ztixyzy0m2fiogywmwnjngm5nguxy2q3lnbuzyisinn0b3jhz2uioijwdwjsawnfc3rvcmuifq?signature=efd4bbab41f7d263b99b0e1dc24dc1c50fe576b0ad6245e4d3f604993c43fb35

You've probably not tasted anything like it before, because this is has not been heat pasteurised or homogenised. This is milk straight from the farm, treated with cold high pressure to make it safe. Enjoy milk as it’s meant to be, only lactose free, so it's easier to digest. Filled with natural enzymes, calcium, protein and vitamins and a deliciously creamy and sweet flavour you'll love. Milk from Grass-fed free range cows.

Raw ...

Foley’s

Foley’s Mustard – Wholegrain (raw fermented) 250g

$11.10 each

Eyjpzci6ime0n2nkogy1ztfkntu4mtewmdrhzmyznzfmzji5yjqzlmpwzyisinn0b3jhz2uioijwdwjsawnfc3rvcmuifq?signature=d30af0ecfca7c98bf3db398763be5cfdb635caedccb37c82038d54e996091e4c

Foley’s Frothing Fermentations mustards have been traditionally fermented in small batches creating a condiment full of beneficial live bacteria, and at the same time, boosting the nutritional health benefits of the ancient mustard seed. Liven up your dishes with this probiotic pantry staple.

Raw, Fermented ...

Amazonia

Amazonia Nutritional Powder (Raw) - Prebiotic Greens 120gm

$34.95 each

Eyjpzci6ijrjm2qzmzlhndyznwzjzta2zwi0mjq3odu5yjkzzjk3iiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=f7ae5a30281ff33ee6a59094b06652f17ca3faec0f45f88543aaf5dd045aded6

With nutrient dense green sprouts, leaves, juices, grasses, algae, herbs and natural sea minerals this product provides a full spectrum of green specific ingredients. Suitable for children and during pregnancy. Sprinkle on cereal, have with yoghurt or add to your favourite juice. Alkalising and vegan, contains live bio available ingredients, GMO free and free from wheat, dairy, eggs, corn, lactose, gluten and caffeine.

Gluten Free, Raw, Vegan, Vegetarian ...

Lettuce Deliver

Lettuce Deliver Nuts - Almonds (Raw - Shelled) 1kg

$44.00 each

Eyjpzci6ije4ztzmmwiwzdhhnmzlmtk1yja4zguwngfmnwq1odi1iiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=aab0f4effd7f7abca951fa6960c5a7c0f175a936d4dcc7ab628e164673ff60bb

Fantastic Almonds from Manna Farms (Keen & Keens) in Nangiloc, Victoria. These Almonds are Demeter certified.

Certified by NASAA, Raw ...

Lettuce Deliver

Lettuce Deliver Nuts - Almonds (Raw - Shelled) 500g

$24.00 each

Eyjpzci6immwotzkmwfkymfjzje3ngjiyzgwytzlm2u1otuxntkyiiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=6a6c62a5d6a81baaf18bc3244a84c883cdbf02abaaac6e1168e1a94dd51fc224

Fantastic Almonds from Manna Farms (Keen & Keens) in Nangiloc, Victoria. These Almonds are Demeter certified.

Certified by NASAA, Raw ...

Lotus

Lotus Nuts - Almonds (Raw - Shelled) 100g

$8.65 each

Eyjpzci6ijnkzwezmjmwztqyytu4zmjimdgwzdcxmjg0zdi2nzzmiiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=c344f27a1fa4b7df6d92eefda6783eeeb95c67d0c20c342871609ec5fd05dfa0

Lotus Organic Raw Almonds are grown, processed and packed in Australia. Enjoy chopped through salads, roasted in the oven or straight from the pack.

Certified by ACO, Raw ...

Lettuce Deliver

Lettuce Deliver Nuts - Almonds (Raw - Shelled) 250g

$13.80 each

Eyjpzci6ijkwnzfjntbkmddlyjuwnjljmzi4mjhhztkwntywode0iiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=b2d91fb52aca19a1997a454ca80bd89042c1151b59fbcdf15ac14c8d3a76c749

Fantastic Almonds from Manna Farms (Keen & Keens) in Nangiloc, Victoria. These Almonds are Demeter certified.

Certified by NASAA, Raw ...

Absolute Organic

Absolute Organic Nuts - Cashews (Raw) 1kg

$39.00 each

Eyjpzci6imrmnde3yzzlzwq4otixnmezyznmmjkyzmvhytq4n2myiiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=3fe79972e8110c70f21e4176395712eacba3cfeb72b1539a808c08857d005e65

Raw cashews are high in protein and magnesium. Enjoy them straight from the pack, or in many different ways. Great in stir fries, soups, desserts and makes a great addition to fruit salad and yoghurt.

Certified by ACO, Raw ...

Absolute Organic

Absolute Organic Nuts - Cashews (Raw) 250gm

$14.90 each

Eyjpzci6ija5owe5ywflmgexzdq4zwu0ndy5y2m1zwm1zjuxowy5iiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=a5cbe75b875e8eb13d41eaed789460c90b5353cad74d2bec6b8d315fa0f862e3

Raw cashews are high in protein and magnesium. Enjoy them straight from the pack, or in many different ways. Great in stir fries, soups, desserts and makes a great addition to fruit salad and yoghurt.

Certified by ACO, Raw ...

Absolute Organic

Absolute Organic Nuts - Trail Mix (Raw) 250gm

$10.20 each

Eyjpzci6imrhnzmwnznjnjcwzgi2zdfinddhmgy4y2i0owjingmwiiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=373ad4e32e01a01364f20a76935ac12ba3f39ef2385bcdd164b26daedc447d97

A fusion of flavour, texture and nutrition from nuts, dried fruits and seeds. This power snack is an ideal on the go food to fuel the body through a busy day. Great source of antioxidants.

Certified by ACO, Raw ...

Absolute Organic

Absolute Organic Oil - Coconut (Extra Virgin/Raw Cold Pressed) 300gm

$7.87 each

Eyjpzci6ijrly2nmm2zmzdvlmddjzwmxotlmnjizmta1y2vhzjbilmpwzyisinn0b3jhz2uioijwdwjsawnfc3rvcmuifq?signature=738ad5c2613ae8fcd78f944efbda5af3b5ff3fd194d51c9ec1da287c2c6ac8f6

Coconut oil is an excellent cooking and frying oil. It has a low smoke point of about 180 degrees. Due to its stability it is slow to oxidize and thus resistant to rancidity. Non hydrogenated. Packing in Australia from imported ingredients.

Certified by ACO, Raw ...

Niugini Organics

Niugini Organics Oil - Coconut (Raw Virgin - Cold Pressed) 650gm

$19.95 each

Eyjpzci6ijk4mdc3mznkmgnhntnizwyzotu5zgmznwnmodnhyjfkiiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=c66b103254dab7983175d73bca2335adf2bfd105e77e07ee64185ea4a6bb320d

Organic coconut oil converts to energy quickly, unlike other oils which tend to store fat and it is also a rich source of Lauric Acid, an all natural shield against infection and body cell changes. Healthy delicious alternative cooking oil, totally cholesterol- free and high in lauric acid. Chemical-free, cholesterol-free and not deodorised.

Certified by OFC, Raw ...

Niugini Organics

Niugini Organics Oil - Coconut (Raw Virgin - Cold Pressed) 1kg

$27.95 each

Eyjpzci6iju1m2q4mgnjnzfmmgewngviyzuzzmm1odk2ndm4mwviiiwic3rvcmfnzsi6inb1ymxpy19zdg9yzsj9?signature=1af9be8d3507ab0ad9fa4c3cb925341422c7432642a2db96d343763538fe54f8

Organic coconut oil converts to energy quickly, unlike other oils which tend to store fat and it is also a rich source of Lauric Acid, an all natural shield against infection and body cell changes. Healthy delicious alternative cooking oil, totally cholesterol- free and high in lauric acid. Chemical-free, cholesterol-free and not deodorised.

Certified by OFC, Raw ...
  1. When you've added something, it will appear here. To see everything in your trolley, use the Review Order & Checkout button.

    Item Cost
  2. Check Delivery Address

Check availability

  1. Check Delivery Address

Location & Contact

Unit 8, 177 Arthur St , Homebush West
NSW, Australia • 2140

02 9763 7337 | sales@lettucedeliver.com.au

Shopping Options

Online shopping available

Delivery

Opening hours

Warehouse Hours: 6am - 4pm Monday to Thursday. 9am - 12 midday Friday. Office Hours: 10am - 4pm Monday to Thursday. 9am - 12 midday Friday.